Jump to content

wolstech

Chief Risk Officer
  • Posts

    18,422
  • Joined

  • Last visited

  • Days Won

    713

Everything posted by wolstech

  1. No. Has nothing to do with security, its just basic networking.
  2. Ricky is still out for rebuild at the moment and isn't running, so no. As for that 3AM, pretty much all of us who've been here a while had to do that at some point. Back in the day the times were PST instead of UTC, and that meant the US East Coast (which includes me) had to deal with 3AM registration times (in fact, that was a major reason it's now UTC...) for a decent hosting account.
  3. I don't see anything wrong with your account or IP address.
  4. Your account has been moved to Tommy. I've also increased your space to the maximum 5000MB based on the size of your donation. Your domains should start working within the next hour or so, SSL may take a little longer. Thank you for the donation
  5. Please check your PMs.
  6. UInarchived.
  7. It's an open network connection. I assume you're looking at this on your own computer. Your browser opens multiple connections to your site when you load the page so it can download the page and all of the related assets like images, JS, CSS, etc. It's normal. The number you will see is directly affected by the content you have on your website, among other things.
  8. To an extent yes, but it depends on the type and size of the attack as to how well it works. During an attack, the server firewall will start blocking IPs that open too many connections. It works well enough to keep the servers up, though there's often a noticeable slowdown.
  9. Done. I've also increased your space to 3000MB. Your site should start working within the next hour or so, and SSL will probably take a little longer. Thank you for the donation
  10. Moving...
  11. Tomcat isn't running for some reason. Someone on Discord mentioned it earlier as well. Krydos has to fix it.
  12. Unblocked again.
  13. Tommy was down for about a half hour this morning due to high load. You can see the intermittent issues as red spots on tommy's performance line here: http://heliohost.grd.net.pl/monitor/
  14. Quantity is unlimited, but speed is "up to 1 gbps" (the max of the server's network interface) with actual realized speeds far lower since you're sharing a physical network card with a bunch of other VPSes and possibly one of the cpanel servers. You're competing for the bandwidth of other users as well as whatever our provider has available.
  15. That script seems to be giving bogus password errors for a lot of people lately. Usually this happens when the server is down due to load, but as with you, the others also said they could still log in (if it was actually load causing this issue, the login page would also fail with a bad password error). Your domain has been manually changed and should start working in the next few hours.
  16. Unblocked. Don't use webdisk. It's very buggy and not really supported anymore. Use SFTP instead. As for those links, the only supported login links for your account are https://heliohost.org/login/ and https://tommy.heliohost.org:2083/ (note the 2083, regular users cannot use 2087, that's WHM and is for admins only). We don't support custom domain cPanel logins (if you try, you'll be sent to https://heliohost.org/login/ ).
  17. What type of connection? For Remote MySQL you have to do yourself in cPanel. For Remote Postgres, you need to tell us what database, what username, and what IP address.
  18. Done. Thank you for the donation
  19. It was for failed SFTP logins. Make sure you use only your cPanel username and password with SFTP. The additional accounts you create in cpanel only work on plain FTP on port 21. Unblocked.
  20. Please remove that service as quickly as possible and don't offer such a service going forward, it'll only result in us receiving similar reports when the links end up involved in spam or illegal activity. The link in question forwarded to a Norton Security affiliate/referrals page and was being sent in spam emails (the sender was hoping to make a quick buck or score free licenses through the referral program most likely). Unsuspended.
  21. And the abuse report in question: We have received a complaint about your account. Please investigate and fix within 24 hours. Hurricane Electric Abuse Department support@he.net From 7113040874.58ba8d50@bounces.spamcop.net Tue Mar 9 10:13:31 2021 Return-Path: <7113040874.58ba8d50@bounces.spamcop.net> X-Original-To: report@abuse.he.net Delivered-To: report@abuse.he.net Received: from mail.he.net (mail.he.net [216.218.186.2]) by abuse.he.net (Postfix) with ESMTPS id EB682542C8C for <report@abuse.he.net>; Tue, 9 Mar 2021 10:13:30 -0800 (PST) Authentication-Results: mail.he.net; spf=pass (mail.he.net: domain of bounces.spamcop.net designates 184.94.240.112 as permitted sender) smtp.mailfrom=7113040874.58ba8d50@bounces.spamcop.net; dmarc=none (Policy up to you. No DMARC record found) header.from=reports.spamcop.net Received-SPF: pass (mail.he.net: domain of bounces.spamcop.net designates 184.94.240.112 as permitted sender) client-ip=184.94.240.112; envelope-from=7113040874.58ba8d50@bounces.spamcop.net; helo=vmx.spamcop.net; Received: from vmx.spamcop.net ([184.94.240.112]) by he.net with ESMTPS (ECDHE-RSA-AES256-GCM-SHA384:TLSv1.2:Kx=ECDH:Au=RSA:Enc=AESGCM(256):Mac=AEAD) for <abuse@he.net>; Tue, 9 Mar 2021 10:13:27 -0800 IronPort-SDR: mFFyMdVbug86w5Wwx2ff6TUlK76v/q5b2Gz6IQs4oC4JL1E1Hoz+sgpZpci4txM/nX8S/K40sG T6k8KhNcieDnx58SYG3+oACC6f5IVbvLd0XGGwzWb5hu9A4UsAfgVgjg9NQLmmdanyb9IC8xYq OpuMoNkSUvx5qnkEak5iwUCqfgnodw5xaP5kskz4my4A7IzEpn+OQ/rNwRMgwekSg4JbIPgudE HNElsdNOmLucvgYEESMeHb+02T8zM4Gdj+CVCPUdBPe6cQxjdPN51DEq42Z9+AZskvzBO+QJIF NLg= Received: from prod-sc-www02.sv4.ironport.com (HELO prod-sc-www02.spamcop.net) ([10.8.129.226]) by prod-sc-smtp-vip.sv4.ironport.com with SMTP; 09 Mar 2021 10:13:27 -0800 Received: from [73.99.51.79] by spamcop.net with HTTP; Tue, 09 Mar 2021 18:13:27 GMT Content-Type: multipart/report; report-type=feedback-report; boundary="----------=_1615313607-17249-1" Content-Transfer-Encoding: 7bit MIME-Version: 1.0 Date: Mon, 08 Mar 2021 13:00:43 -0500 From: "Koakoa" <7113040874@reports.spamcop.net> To: abuse@he.net Subject: [SpamCop (https://www.link.edvicon.org/myfla) id:7113040874]Your Personal information are not protected, Scan .. Precedence: list Message-ID: <rid_7113040874@msgid.spamcop.net> X-Mailer: https://www.spamcop.net/ v5.3.0 X-Spamcop-Sourceip: 74.63.221.29 This is a multi-part message in MIME format... ------------=_1615313607-17249-1 Content-Type: text/plain; charset="charset=ISO-8859-1; format=flowed" Content-Disposition: inline Content-Transfer-Encoding: 7bit [ SpamCop V5.3.0 ] This message is brief for your comfort. Please use links below for details. Spamvertised web site: https://www.link.edvicon.org/myfla https://www.spamcop.net/w3m?i=z7113040874z58ba8d50670b1df7b27cf65ebb55e826z https://www.link.edvicon.org/myfla is 65.19.143.6; Tue, 09 Mar 2021 18:13:21 GMT This is an email abuse report for an email message received from IP source 74.63.221.29 on Mon, 08 Mar 2021 13:00:43 -0500 For more information about this format please see http://www.mipassoc.org/arf/ To change ARF message format to SpamCop format change settings on your preferences page: https://www.spamcop.net/mcgi?action=showispprefs ------------=_1615313607-17249-1 Content-Type: message/feedback-report Content-Disposition: inline Content-Transfer-Encoding: 7bit Feedback-Type: abuse User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:86.0) Gecko/20100101 Firefox/86.0 via https://www.spamcop.net Version: 0.1 Received-Date: Mon, 08 Mar 2021 13:00:43 -0500 Source-IP: 74.63.221.29 ------------=_1615313607-17249-1 Content-Type: message/rfc822; Content-Disposition: inline Content-Transfer-Encoding: binary "From - Mon Mar 8 16:34:59 2021 " X-Account-Key: account11 X-UIDL: 319083.0kvef6F6DGO3Lwynpauwx9zy8YQ= X-Mozilla-Status: 0000 X-Mozilla-Status2: 00000000 X-Mozilla-Keys: Received: from mx02.rcn.cmh.synacor.com (LHLO mx.rcn.com) (10.33.3.180) by md07.rcn.cmh.synacor.com with LMTP; Mon, 8 Mar 2021 13:01:00 -0500 (EST) Return-Path: <> X-Received-HELO: from [74.63.221.29] (helo=paper.ycvweb.com) Authentication-Results: mx02.rcn.cmh.synacor.com smtp.mail=postmaster@paper.ycvweb.com; spf=neutral; sender-id=neutral Authentication-Results: mx02.rcn.cmh.synacor.com header.from=boxLight4.LE2BLOHE5J8EDS4E2TOAXPPL6167TC@fm.com; sender-id=neutral Received-SPF: neutral (mx02.rcn.cmh.synacor.com: 74.63.221.29 is neither permitted nor denied by domain of paper.ycvweb.com) Received: from [74.63.221.29] ([74.63.221.29:34769] helo=paper.ycvweb.com) by mx.rcn.com (envelope-from <>) (ecelerity 3.6.25.56547 r(Core:3.6.25.0)) with ESMTP id 4A/BD-57799-A4666406; Mon, 08 Mar 2021 13:00:43 -0500 Received: by fm.com (Postfix, from userid 100) id HX6WC8OWDURD1YA76DYHRJVBXB6V41;Mon, 8 Mar 2021 13:00:19 -0500 To: x Date: Mon, 8 Mar 2021 13:00:19 -0500 Accept-Language: en-US, en-GB Content-Language: en-US From: Virus detected<KCJA6YNK4X6X4QTT6A2EIC1UYE6OAP.geo-mmmmm@fm.com> Subject: Your Personal information are not protected, Scan now! Message-Id: <BNVE______________________ET9Z@fm.com> X_DLP_INBOUND: true Importance: high X-Priority: 1 X_DLP_INBOUND: true MIME-Version: 1.0 Content-Transfer-Encoding: 8bit Content-Disposition: inline Content-Type: multipart/alternative;boundary=--boundary_36347130_f7d50c66-0077-4e20-a6a0-8e909d2c1ffd Sender: <boxLight4.LE2BLOHE5J8EDS4E2TOAXPPL6167TC@fm.com> X-Vade-Verdict: clean X-Vade-Analysis: gggruggvucftvghtrhhoucdtuddrgeduledruddugedggeegucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuufgjpfetvefqtfdptfevpfenuceurghilhhouhhtmecufedtudenucfqnhhlhicuohhnvgcuphgrrhhtucdlhedumdenucfjughrpefvfffhuffkkgfrggfguggtshesrgekggertddtjeenucfhrhhomhepgghirhhushcuuggvthgvtghtvgguoefmveflteeijgfpmfegigeiigegsffvvfeitedvgffkvedufggjgfeiqfetrfdrghgvohdqmhhmmhhmmhesfhhmrdgtohhmqeenucggtffrrghtthgvrhhnpeffueejiedujeejvdevgeelteeivdejffetkeekudeivddvhedugeelgefgtedtvdenucffohhmrghinhepvgguvhhitghonhdrohhrghdpghhoohhglhgvrdgtohhmnecukfhppeejgedrieefrddvvddurddvleenucevlhhushhtvghrufhiiigvpedvkeejieenucfrrghrrghmpehinhgvthepjeegrdeifedrvddvuddrvdelnedpmhgrihhlfhhrohhmpeenpdhrtghpthhtoheprghlsggvrhhtshhonhhkohesvghrohhlshdrtghomhen X-Vade-Client: RCN ----boundary_36347130_f7d50c66-0077-4e20-a6a0-8e909d2c1ffd Content-Type: text/html; charset=utf-8 Content-Transfer-Encoding: quoted-printable <center><h1></h1> <a href="https://www.link.edvicon.org/myfla"> <img src="https://www.link.edvicon.org/0d883"></a> <br> <a href="https://google.com/c1hooe"> <img src="https://google.com/o5nysg" style="display:none;" alt="fsz"></a> </center> ------------=_1615313607-17249-1-- The links shown at the bottom of the report above were being advertised in spam email. From the looks of it, I suspect that whatever is at link.edvicon.org is hacked or was otherwise abused/compromised. Can you explain what happened here? Also, are you able to remove those links and ensure that no such material is hosted on your site or advertised via spam going forward?
  22. I can't speak to react as I'm not familiar with it (if it's a library of some sort that you just upload as part of your code, it might work, if it's a replacement for node, it won't). Node.js itself is supported: https://wiki.helionet.org/tutorials/node.js
  23. DOS 42 Connections. During a DOS attack, the server's firewall becomes extremely sensitive to high connection counts (it's worth nothing that this is not normal behavior and is only temporary, it's just a mitigation we apply when a botnet hits us to avoid our servers going down). You said you're working with MySQL...are you using remote MySQL? If so, that can cause this as well. Also, if you're constantly refreshing your website (especially one with lots of graphics/CSS/scripts) as part of testing/development, that can also trigger this. Once the attack ends and the mitigation is lifted, this won't happen anymore. Unblocked again.
  24. That's by design. We don't allow users to log into cpanel using custom domains because our ads don't pay us if we do. Only urls that are in the format something.heliohost.us or something.heliohost.org will work for accessing cpanel.
  25. To explain that reason, that's just bad luck, not your fault. If the DOS prevention service is running due to an attack and you do something intensive like upload a lot of files by FTP, this can happen.
×
×
  • Create New...