Jump to content

nimeshk

Members
  • Posts

    41
  • Joined

  • Last visited

Everything posted by nimeshk

  1. Hi team, Is there any updates on this? Do you have any ETA? Thanks. Best Regards, Nimesh
  2. Hi Admin, Thank you for the support. I have already informed the IT team to take this down. It'll be removed completely within next 24 hours. BR, Nimesh
  3. And the abuse report in question: We have received a complaint about your account. Please investigate and fix within 24 hours. Hurricane Electric Abuse Department support@he.net From 7113040874.58ba8d50@bounces.spamcop.net Tue Mar 9 10:13:31 2021 Return-Path: <7113040874.58ba8d50@bounces.spamcop.net> X-Original-To: report@abuse.he.net Delivered-To: report@abuse.he.net Received: from mail.he.net (mail.he.net [216.218.186.2]) by abuse.he.net (Postfix) with ESMTPS id EB682542C8C for <report@abuse.he.net>; Tue, 9 Mar 2021 10:13:30 -0800 (PST) Authentication-Results: mail.he.net; spf=pass (mail.he.net: domain of bounces.spamcop.net designates 184.94.240.112 as permitted sender) smtp.mailfrom=7113040874.58ba8d50@bounces.spamcop.net; dmarc=none (Policy up to you. No DMARC record found) header.from=reports.spamcop.net Received-SPF: pass (mail.he.net: domain of bounces.spamcop.net designates 184.94.240.112 as permitted sender) client-ip=184.94.240.112; envelope-from=7113040874.58ba8d50@bounces.spamcop.net; helo=vmx.spamcop.net; Received: from vmx.spamcop.net ([184.94.240.112]) by he.net with ESMTPS (ECDHE-RSA-AES256-GCM-SHA384:TLSv1.2:Kx=ECDH:Au=RSA:Enc=AESGCM(256):Mac=AEAD) for <abuse@he.net>; Tue, 9 Mar 2021 10:13:27 -0800 IronPort-SDR: mFFyMdVbug86w5Wwx2ff6TUlK76v/q5b2Gz6IQs4oC4JL1E1Hoz+sgpZpci4txM/nX8S/K40sG T6k8KhNcieDnx58SYG3+oACC6f5IVbvLd0XGGwzWb5hu9A4UsAfgVgjg9NQLmmdanyb9IC8xYq OpuMoNkSUvx5qnkEak5iwUCqfgnodw5xaP5kskz4my4A7IzEpn+OQ/rNwRMgwekSg4JbIPgudE HNElsdNOmLucvgYEESMeHb+02T8zM4Gdj+CVCPUdBPe6cQxjdPN51DEq42Z9+AZskvzBO+QJIF NLg= Received: from prod-sc-www02.sv4.ironport.com (HELO prod-sc-www02.spamcop.net) ([10.8.129.226]) by prod-sc-smtp-vip.sv4.ironport.com with SMTP; 09 Mar 2021 10:13:27 -0800 Received: from [73.99.51.79] by spamcop.net with HTTP; Tue, 09 Mar 2021 18:13:27 GMT Content-Type: multipart/report; report-type=feedback-report; boundary="----------=_1615313607-17249-1" Content-Transfer-Encoding: 7bit MIME-Version: 1.0 Date: Mon, 08 Mar 2021 13:00:43 -0500 From: "Koakoa" <7113040874@reports.spamcop.net> To: abuse@he.net Subject: [SpamCop (https://www.link.edvicon.org/myfla) id:7113040874]Your Personal information are not protected, Scan .. Precedence: list Message-ID: <rid_7113040874@msgid.spamcop.net> X-Mailer: https://www.spamcop.net/ v5.3.0 X-Spamcop-Sourceip: 74.63.221.29 This is a multi-part message in MIME format... ------------=_1615313607-17249-1 Content-Type: text/plain; charset="charset=ISO-8859-1; format=flowed" Content-Disposition: inline Content-Transfer-Encoding: 7bit [ SpamCop V5.3.0 ] This message is brief for your comfort. Please use links below for details. Spamvertised web site: https://www.link.edvicon.org/myfla https://www.spamcop.net/w3m?i=z7113040874z58ba8d50670b1df7b27cf65ebb55e826z https://www.link.edvicon.org/myfla is 65.19.143.6; Tue, 09 Mar 2021 18:13:21 GMT This is an email abuse report for an email message received from IP source 74.63.221.29 on Mon, 08 Mar 2021 13:00:43 -0500 For more information about this format please see http://www.mipassoc.org/arf/ To change ARF message format to SpamCop format change settings on your preferences page: https://www.spamcop.net/mcgi?action=showispprefs ------------=_1615313607-17249-1 Content-Type: message/feedback-report Content-Disposition: inline Content-Transfer-Encoding: 7bit Feedback-Type: abuse User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:86.0) Gecko/20100101 Firefox/86.0 via https://www.spamcop.net Version: 0.1 Received-Date: Mon, 08 Mar 2021 13:00:43 -0500 Source-IP: 74.63.221.29 ------------=_1615313607-17249-1 Content-Type: message/rfc822; Content-Disposition: inline Content-Transfer-Encoding: binary "From - Mon Mar 8 16:34:59 2021 " X-Account-Key: account11 X-UIDL: 319083.0kvef6F6DGO3Lwynpauwx9zy8YQ= X-Mozilla-Status: 0000 X-Mozilla-Status2: 00000000 X-Mozilla-Keys: Received: from mx02.rcn.cmh.synacor.com (LHLO mx.rcn.com) (10.33.3.180) by md07.rcn.cmh.synacor.com with LMTP; Mon, 8 Mar 2021 13:01:00 -0500 (EST) Return-Path: <> X-Received-HELO: from [74.63.221.29] (helo=paper.ycvweb.com) Authentication-Results: mx02.rcn.cmh.synacor.com smtp.mail=postmaster@paper.ycvweb.com; spf=neutral; sender-id=neutral Authentication-Results: mx02.rcn.cmh.synacor.com header.from=boxLight4.LE2BLOHE5J8EDS4E2TOAXPPL6167TC@fm.com; sender-id=neutral Received-SPF: neutral (mx02.rcn.cmh.synacor.com: 74.63.221.29 is neither permitted nor denied by domain of paper.ycvweb.com) Received: from [74.63.221.29] ([74.63.221.29:34769] helo=paper.ycvweb.com) by mx.rcn.com (envelope-from <>) (ecelerity 3.6.25.56547 r(Core:3.6.25.0)) with ESMTP id 4A/BD-57799-A4666406; Mon, 08 Mar 2021 13:00:43 -0500 Received: by fm.com (Postfix, from userid 100) id HX6WC8OWDURD1YA76DYHRJVBXB6V41;Mon, 8 Mar 2021 13:00:19 -0500 To: x Date: Mon, 8 Mar 2021 13:00:19 -0500 Accept-Language: en-US, en-GB Content-Language: en-US From: Virus detected<KCJA6YNK4X6X4QTT6A2EIC1UYE6OAP.geo-mmmmm@fm.com> Subject: Your Personal information are not protected, Scan now! Message-Id: <BNVE______________________ET9Z@fm.com> X_DLP_INBOUND: true Importance: high X-Priority: 1 X_DLP_INBOUND: true MIME-Version: 1.0 Content-Transfer-Encoding: 8bit Content-Disposition: inline Content-Type: multipart/alternative;boundary=--boundary_36347130_f7d50c66-0077-4e20-a6a0-8e909d2c1ffd Sender: <boxLight4.LE2BLOHE5J8EDS4E2TOAXPPL6167TC@fm.com> X-Vade-Verdict: clean X-Vade-Analysis: gggruggvucftvghtrhhoucdtuddrgeduledruddugedggeegucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuufgjpfetvefqtfdptfevpfenuceurghilhhouhhtmecufedtudenucfqnhhlhicuohhnvgcuphgrrhhtucdlhedumdenucfjughrpefvfffhuffkkgfrggfguggtshesrgekggertddtjeenucfhrhhomhepgghirhhushcuuggvthgvtghtvgguoefmveflteeijgfpmfegigeiigegsffvvfeitedvgffkvedufggjgfeiqfetrfdrghgvohdqmhhmmhhmmhesfhhmrdgtohhmqeenucggtffrrghtthgvrhhnpeffueejiedujeejvdevgeelteeivdejffetkeekudeivddvhedugeelgefgtedtvdenucffohhmrghinhepvgguvhhitghonhdrohhrghdpghhoohhglhgvrdgtohhmnecukfhppeejgedrieefrddvvddurddvleenucevlhhushhtvghrufhiiigvpedvkeejieenucfrrghrrghmpehinhgvthepjeegrdeifedrvddvuddrvdelnedpmhgrihhlfhhrohhmpeenpdhrtghpthhtoheprghlsggvrhhtshhonhhkohesvghrohhlshdrtghomhen X-Vade-Client: RCN ----boundary_36347130_f7d50c66-0077-4e20-a6a0-8e909d2c1ffd Content-Type: text/html; charset=utf-8 Content-Transfer-Encoding: quoted-printable <center><h1></h1> <a href="https://www.link.edvicon.org/myfla"> <img src="https://www.link.edvicon.org/0d883"></a> <br> <a href="https://google.com/c1hooe"> <img src="https://google.com/o5nysg" style="display:none;" alt="fsz"></a> </center> ------------=_1615313607-17249-1-- Can you explain what happened here? Hi Admin, Thank you for quick response. link.edvicon.org is a URL shortning service. So users can shorten their lengthy URLs. It seems that someone has use this for malicious activities. Since the server is down, I'm unable to test the mentioned link in the report: https://www.link.edvicon.org/myfla This is a sub service we provided. But if it needs to be removed, we can take that service down. Because other services are important for us than this. Please let me know your reply. Thank you. BR, Nimesh
  4. Hi Admin, * Username: edvicon * Server: Tommy * Main Domain: edvicon.heliohost.org (www.edvicon.org) My account was suspended suddenly. Can you please unsuspend it for me? And I would like to know the reason for this suspension. So that I can ensure this won't happen again. This service is very important for us, as this site represents a non-profit start-up. So please help me fast as you can. Best Regards, Nimesh
  5. Mm yes please, for now please increase 200 MB. I will be making $5 later. Thank you admin.
  6. I see. then can I get some extra storage to that account then? otherwise, there won't be enough space for both sites.
  7. Hi Admin, Yes, edvicon is for the domain edvicon.org and we are in need of maintaining another site edvicon.edu.lk for another purpose. That's why we have two accounts separately. And both accounts are belongs to one organization. that's why I requested the same using this account. Do let me know what should I do next. Thank you.
  8. Hi Admin, Thank you for the quick response. Can you please transfer this to Tommy server then please? I need git only to get files from my GitHub repo. Because all the website files are being updated there. Also, the I added the domain less than 24 hours. I will be waiting for the SSL. Thank you. Admins can move you if you donate $1. https://heliohost.org/donate Otherwise you need to take a backup, download it, delete your account and wait until midnight UTC to sign up again on Tommy More info can be found here: https://wiki.helionet.org/accounts/moving-your-account Hi Admin, Thank you for the response. I have donated as requested. Transaction ID: 20427066945012392 Please do help me in changing the server and activating Git feature in tommy server. Thank you.
  9. Hi Admin, Thank you for the quick response. Can you please transfer this to Tommy server then please? I need git only to get files from my GitHub repo. Because all the website files are being updated there. Also, the I added the domain less than 24 hours. I will be waiting for the SSL. Thank you.
  10. Hi, Is it possible for me to enable git version control option in cPannel? My username: edvicone Server: ricky And I want to know, whether the AutoSSL will be enabled for the added domain edvicon.edu.lk? Awaiting your assistance. Thank you. Regards, Nimesh
  11. I mistakenly entered wrong password to SFTP client and tried several times to login. I thought server error. Yet, it seems the password is incorrect. Please help me with unblocking my IP. Thank you.
  12. I'm sorry. It works now. It seems it took a while to renew. Please ignore this support request. I couldn't find an option to delete this. Thanks.
  13. Hi, Username is Edvicon. The account has been deactivated due to no login for 30 days. I tried renew option. But still I can not log into control panel. Can you please help me with this. My website receiving visitors from various countries. So, have the site down is a bad image for the organization. Please help. Thank you.
  14. Oh, I see. Then it's their fault. I really appreciate this support forum. You guys are such a friendly people.
  15. Yeah. May be the some thing must have missing with the script. thanks guys for the support again.
  16. changing the particular subdomain to PHP 5.6 worked. Thank you so much.
  17. PHP Version 7.3.14 Any advice to solve this issue, please?
  18. Yes, on my PC I run Apache on windows. and these are the requirements: Requirements- PHP 5.4.0 or above - PDO and MySQLI extension - GD Extension - Multibyte String (Mbstring) - Rewrite module - WHOIS Port – TCP 43 must be allowed - “allow_url_fopen” must be allowed. - SMTP Mail Server (optional) This is the script URL: https://codecanyon.net/item/turbo-website-reviewer-indepth-seo-analysis-tool/20069330
  19. Forgot to attach the screenshot. Sorry.
  20. I bought a web script of website analysis. It runs perfectly on my localhost in my PC. But when I install in my web server it shows some unreadable texts only in one decation. (Overview section. You can check the error here: https://www.review.edvicon.org/domain/edvicon.org. Also I attached a screenshot here. Please do let me know if it is a server error? and how should I correct it. Because the script is working fine in localhost. Please do let me know soon. It's bit urgent to solve this. Thank you.
  21. Done. Thank you for the support. Anyway the port I mentioned was showing within my CPanel. Still it is. Thank you guys for the support.
  22. Few weeks ago it worked, I used my saved credentials. So nothing was changed.
  23. I tried these configurations shown ion Cpanel: SFTP host: tommy.heliohost.org SFTP port: 1373 SFTP protocol: SFTP SFTP logon type: Normal SFTP Username: edvicon SFTP password: <same as cpanel> But it didn't work.
  24. I think yes. But it worked previously. Any how I can try SFTP. But since I haven't try it before can you guide me how to use SFTP on FileZilla? I mean what should I enter to those fields to connect?
  25. I tried to connect using FileZilla to my web server with correct credentials, it shows as 'logged in' but directory listing is not successful. It worked few weeks ago. Now this error is receiving for few days. I thought it's some server error. But the problem still there. I've attached a screenshot of the window. Please provide me a fast solution. Thank you.
×
×
  • Create New...