Jump to content

nimeshk

Members
 View Profile  See their activity

  • Posts

    41

  • Joined

  • Last visited

 Content Type 

Posts posted by nimeshk

    [Solved] Suspended: edvicon

    in Suspended and Queued Accounts

    Posted

     

     

    Abuse report. Dubious and/or malicious links at link.edvicon.org

     

     

    And the abuse report in question:

    We have received a complaint about your account. Please investigate and fix within 24 hours.

Hurricane Electric Abuse Department
support@he.net

From 7113040874.58ba8d50@bounces.spamcop.net  Tue Mar  9 10:13:31 2021
Return-Path: <7113040874.58ba8d50@bounces.spamcop.net>
X-Original-To: report@abuse.he.net
Delivered-To: report@abuse.he.net
Received: from mail.he.net (mail.he.net [216.218.186.2])
        by abuse.he.net (Postfix) with ESMTPS id EB682542C8C
        for <report@abuse.he.net>; Tue,  9 Mar 2021 10:13:30 -0800 (PST)
Authentication-Results: mail.he.net;
        spf=pass (mail.he.net: domain of bounces.spamcop.net designates 184.94.240.112 as permitted sender) smtp.mailfrom=7113040874.58ba8d50@bounces.spamcop.net;
        dmarc=none (Policy up to you. No DMARC record found) header.from=reports.spamcop.net
Received-SPF: pass (mail.he.net: domain of bounces.spamcop.net designates 184.94.240.112 as permitted sender) client-ip=184.94.240.112; envelope-from=7113040874.58ba8d50@bounces.spamcop.net; helo=vmx.spamcop.net;
Received: from vmx.spamcop.net ([184.94.240.112])
        by he.net with ESMTPS (ECDHE-RSA-AES256-GCM-SHA384:TLSv1.2:Kx=ECDH:Au=RSA:Enc=AESGCM(256):Mac=AEAD)
        for <abuse@he.net>; Tue, 9 Mar 2021 10:13:27 -0800
IronPort-SDR: mFFyMdVbug86w5Wwx2ff6TUlK76v/q5b2Gz6IQs4oC4JL1E1Hoz+sgpZpci4txM/nX8S/K40sG
 T6k8KhNcieDnx58SYG3+oACC6f5IVbvLd0XGGwzWb5hu9A4UsAfgVgjg9NQLmmdanyb9IC8xYq
 OpuMoNkSUvx5qnkEak5iwUCqfgnodw5xaP5kskz4my4A7IzEpn+OQ/rNwRMgwekSg4JbIPgudE
 HNElsdNOmLucvgYEESMeHb+02T8zM4Gdj+CVCPUdBPe6cQxjdPN51DEq42Z9+AZskvzBO+QJIF
 NLg=
Received: from prod-sc-www02.sv4.ironport.com (HELO prod-sc-www02.spamcop.net) ([10.8.129.226])
  by prod-sc-smtp-vip.sv4.ironport.com with SMTP; 09 Mar 2021 10:13:27 -0800
Received: from [73.99.51.79] by spamcop.net
        with HTTP; Tue, 09 Mar 2021 18:13:27 GMT
Content-Type: multipart/report; report-type=feedback-report;
 boundary="----------=_1615313607-17249-1"
Content-Transfer-Encoding: 7bit
MIME-Version: 1.0
Date: Mon, 08 Mar 2021 13:00:43 -0500
From: "Koakoa" <7113040874@reports.spamcop.net>
To: abuse@he.net
Subject: [SpamCop (https://www.link.edvicon.org/myfla) id:7113040874]Your
 Personal information are not protected, Scan ..
Precedence: list
Message-ID: <rid_7113040874@msgid.spamcop.net>
X-Mailer: https://www.spamcop.net/ v5.3.0
X-Spamcop-Sourceip: 74.63.221.29

This is a multi-part message in MIME format...

------------=_1615313607-17249-1
Content-Type: text/plain; charset="charset=ISO-8859-1; format=flowed"
Content-Disposition: inline
Content-Transfer-Encoding: 7bit

[ SpamCop V5.3.0 ]
This message is brief for your comfort.  Please use links below for details.

Spamvertised web site: https://www.link.edvicon.org/myfla
https://www.spamcop.net/w3m?i=z7113040874z58ba8d50670b1df7b27cf65ebb55e826z
https://www.link.edvicon.org/myfla is 65.19.143.6; Tue, 09 Mar 2021 18:13:21 GMT


This is an email abuse report for an email message received from IP source 74.63.221.29 on Mon, 08 Mar 2021 13:00:43 -0500
For more information about this format please see http://www.mipassoc.org/arf/
To change ARF message format to SpamCop format change settings on your preferences page: https://www.spamcop.net/mcgi?action=showispprefs

------------=_1615313607-17249-1
Content-Type: message/feedback-report
Content-Disposition: inline
Content-Transfer-Encoding: 7bit

Feedback-Type: abuse
User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:86.0) Gecko/20100101 Firefox/86.0
        via https://www.spamcop.net
Version: 0.1
Received-Date: Mon, 08 Mar 2021 13:00:43 -0500
Source-IP: 74.63.221.29


------------=_1615313607-17249-1
Content-Type: message/rfc822;
Content-Disposition: inline
Content-Transfer-Encoding: binary

"From - Mon Mar  8 16:34:59 2021
"
X-Account-Key: account11
X-UIDL: 319083.0kvef6F6DGO3Lwynpauwx9zy8YQ=
X-Mozilla-Status: 0000
X-Mozilla-Status2: 00000000
X-Mozilla-Keys:                                                                                 
Received: from mx02.rcn.cmh.synacor.com (LHLO mx.rcn.com) (10.33.3.180) by
 md07.rcn.cmh.synacor.com with LMTP; Mon, 8 Mar 2021 13:01:00 -0500 (EST)
Return-Path: <>
X-Received-HELO: from [74.63.221.29] (helo=paper.ycvweb.com)
Authentication-Results: mx02.rcn.cmh.synacor.com smtp.mail=postmaster@paper.ycvweb.com; spf=neutral; sender-id=neutral
Authentication-Results: mx02.rcn.cmh.synacor.com header.from=boxLight4.LE2BLOHE5J8EDS4E2TOAXPPL6167TC@fm.com; sender-id=neutral
Received-SPF: neutral (mx02.rcn.cmh.synacor.com: 74.63.221.29 is neither permitted nor denied by domain of paper.ycvweb.com)
Received: from [74.63.221.29] ([74.63.221.29:34769] helo=paper.ycvweb.com)
        by mx.rcn.com (envelope-from <>)
        (ecelerity 3.6.25.56547 r(Core:3.6.25.0)) with ESMTP
        id 4A/BD-57799-A4666406; Mon, 08 Mar 2021 13:00:43 -0500
Received: by fm.com (Postfix, from userid 100) id HX6WC8OWDURD1YA76DYHRJVBXB6V41;Mon, 8 Mar 2021 13:00:19 -0500
To: x
Date: Mon, 8 Mar 2021 13:00:19 -0500
Accept-Language: en-US, en-GB
Content-Language: en-US
From: Virus detected<KCJA6YNK4X6X4QTT6A2EIC1UYE6OAP.geo-mmmmm@fm.com>
Subject: Your Personal information are not protected, Scan now!
Message-Id: <BNVE______________________ET9Z@fm.com>
X_DLP_INBOUND: true
Importance: high
X-Priority: 1
X_DLP_INBOUND: true
MIME-Version: 1.0
Content-Transfer-Encoding: 8bit
Content-Disposition: inline
Content-Type: multipart/alternative;boundary=--boundary_36347130_f7d50c66-0077-4e20-a6a0-8e909d2c1ffd
Sender: <boxLight4.LE2BLOHE5J8EDS4E2TOAXPPL6167TC@fm.com>
X-Vade-Verdict: clean
X-Vade-Analysis: gggruggvucftvghtrhhoucdtuddrgeduledruddugedggeegucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuufgjpfetvefqtfdptfevpfenuceurghilhhouhhtmecufedtudenucfqnhhlhicuohhnvgcuphgrrhhtucdlhedumdenucfjughrpefvfffhuffkkgfrggfguggtshesrgekggertddtjeenucfhrhhomhepgghirhhushcuuggvthgvtghtvgguoefmveflteeijgfpmfegigeiigegsffvvfeitedvgffkvedufggjgfeiqfetrfdrghgvohdqmhhmmhhmmhesfhhmrdgtohhmqeenucggtffrrghtthgvrhhnpeffueejiedujeejvdevgeelteeivdejffetkeekudeivddvhedugeelgefgtedtvdenucffohhmrghinhepvgguvhhitghonhdrohhrghdpghhoohhglhgvrdgtohhmnecukfhppeejgedrieefrddvvddurddvleenucevlhhushhtvghrufhiiigvpedvkeejieenucfrrghrrghmpehinhgvthepjeegrdeifedrvddvuddrvdelnedpmhgrihhlfhhrohhmpeenpdhrtghpthhtoheprghlsggvrhhtshhonhhkohesvghrohhlshdrtghomhen
X-Vade-Client: RCN



----boundary_36347130_f7d50c66-0077-4e20-a6a0-8e909d2c1ffd
Content-Type: text/html; charset=utf-8
Content-Transfer-Encoding: quoted-printable

<center><h1></h1>
  <a href="https://www.link.edvicon.org/myfla">
<img src="https://www.link.edvicon.org/0d883"></a>
    <br>
    <a href="https://google.com/c1hooe">
<img src="https://google.com/o5nysg" style="display:none;" alt="fsz"></a>
</center>

------------=_1615313607-17249-1--

    Can you explain what happened here?

     

     

    Hi Admin,

     

    Thank you for quick response.

     

    link.edvicon.org is a URL shortning service. So users can shorten their lengthy URLs. It seems that someone has use this for malicious activities. Since the server is down, I'm unable to test the mentioned link in the report: https://www.link.edvicon.org/myfla

     

    This is a sub service we provided. But if it needs to be removed, we can take that service down. Because other services are important for us than this.

     

    Please let me know your reply.

     

    Thank you.

     

    BR,

    Nimesh

    [Solved] Suspended: edvicon

    in Suspended and Queued Accounts

    Posted

    Hi Admin,

     

    * Username: edvicon

    * Server: Tommy

    * Main Domain: edvicon.heliohost.org (www.edvicon.org)

     

    My account was suspended suddenly. Can you please unsuspend it for me? And I would like to know the reason for this suspension. So that I can ensure this won't happen again. This service is very important for us, as this site represents a non-profit start-up. So please help me fast as you can.

     

    Best Regards,

    Nimesh

    [Solved] Requesting Feature in cPannel

    in Escalated Requests

    Posted

    Definitely. The extra space is a one time donation of $5 per 1000 MB up to 5000 MB maximum, and you get to keep the extra space for as long as you have the account. We raise the maximum usually 1000 MB each year or so when we start a new fundraiser. We raised it 2000 MB this year though. The only transaction I know of was for $1. Were there any other donations? We usually require at least $5 to increase the storage at all, but I suppose I could increase it by 200 MB for $1 if that's all you need.

     

    Mm yes please, for now please increase 200 MB. I will be making $5 later. Thank you admin. :)

    [Solved] Requesting Feature in cPannel

    in Escalated Requests

    Posted

    I just noticed you have an account called edvicone on Ricky and an account called edvicon already on Tommy. Keep in mind that each user is allowed to have 1 account total according to our terms of service.

     

    Hi Admin,

     

    Yes, edvicon is for the domain edvicon.org and we are in need of maintaining another site edvicon.edu.lk for another purpose. That's why we have two accounts separately. And both accounts are belongs to one organization. that's why I requested the same using this account. 

     

    Do let me know what should I do next. Thank you.

    [Solved] Requesting Feature in cPannel

    in Escalated Requests

    Posted

     

     

    Git is available in Tommy and Johnny's cpanel, and will be available on Ricky too once we rebuild him. Ricky's rebuild was scheduled for February or so of this year, but it got delayed because it's not safe to travel during a pandemic and we can't get anyone to the datacenter to do the required work. Once we can get someone to the datacenter rebuilding Ricky will be our top priority because he's long overdue for it. In the meantime we recommend moving to Tommy if you need git. Keep in mind that ssh access is disabled for all of our shared hosting because it is too much of a security risk so you won't be able to view clone urls even if you switch servers.

     

    For full access to git functionality we recommend getting a VPS where you will have root access to the entire server to run any commands such as git that you want. Now is a great time to sign up for a VPS because we're having a sale that will only last until we reach the goal of our fundraiser. With any VPS subscription you get an extra 1 GB memory for free, and if you signup for 6 months you can get 10% off as well. So you can get 2GB memory, 2 CPUs, and 50 GB hard drive for only $3.60 per month for 6 months. That's an amazing deal. https://www.heliohost.org/vps/

     

    As far as autossl, it can take up to 24 hours for a new domain to get secured. How long ago did you add that domain? If it's been more than 24 hours we can take a closer look.

     

    Hi Admin,

     

    Thank you for the quick response.

     

    Can you please transfer this to Tommy server then please? I need git only to get files from my GitHub repo. Because all the website files are being updated there.

     

    Also, the I added the domain less than 24 hours. I will be waiting for the SSL. 

     

    Thank you. 

     

     

    Admins can move you if you donate $1.

     

    https://heliohost.org/donate

     

    Otherwise you need to take a backup, download it, delete your account and wait until midnight UTC to sign up again on Tommy

     

    More info can be found here:

     

    https://wiki.helionet.org/accounts/moving-your-account

     

    :)

     

     

    Hi Admin,

     

    Thank you for the response. I have donated as requested. Transaction ID: 20427066945012392

     

    Please do help me in changing the server and activating Git feature in tommy server.

     

    Thank you. 

    [Solved] Requesting Feature in cPannel

    in Escalated Requests

    Posted

    Git is available in Tommy and Johnny's cpanel, and will be available on Ricky too once we rebuild him. Ricky's rebuild was scheduled for February or so of this year, but it got delayed because it's not safe to travel during a pandemic and we can't get anyone to the datacenter to do the required work. Once we can get someone to the datacenter rebuilding Ricky will be our top priority because he's long overdue for it. In the meantime we recommend moving to Tommy if you need git. Keep in mind that ssh access is disabled for all of our shared hosting because it is too much of a security risk so you won't be able to view clone urls even if you switch servers.

     

    For full access to git functionality we recommend getting a VPS where you will have root access to the entire server to run any commands such as git that you want. Now is a great time to sign up for a VPS because we're having a sale that will only last until we reach the goal of our fundraiser. With any VPS subscription you get an extra 1 GB memory for free, and if you signup for 6 months you can get 10% off as well. So you can get 2GB memory, 2 CPUs, and 50 GB hard drive for only $3.60 per month for 6 months. That's an amazing deal. https://www.heliohost.org/vps/

     

    As far as autossl, it can take up to 24 hours for a new domain to get secured. How long ago did you add that domain? If it's been more than 24 hours we can take a closer look.

     

    Hi Admin,

     

    Thank you for the quick response.

     

    Can you please transfer this to Tommy server then please? I need git only to get files from my GitHub repo. Because all the website files are being updated there.

     

    Also, the I added the domain less than 24 hours. I will be waiting for the SSL. 

     

    Thank you. 

    [Solved] Account Renew: Urgent

    in Suspended and Queued Accounts

    Posted

    Hi, Username is Edvicon.

     

    The account has been deactivated due to no login for 30 days. I tried renew option. But still I can not log into control panel. Can you please help me with this. My website receiving visitors from various countries. So, have the site down is a bad image for the organization. Please help. Thank you.

    Error in Text of a Script

    in Customer Service

    Posted

    Looks like they just badly implemented the PHP 7 support. I grabbed a PHP 7 XAMPP and had the same weird bugs (using the same exact config on your account, when I tested this I just downloaded your install off your account and just changed the database settings for xampp's mysql).

     

    IMO, 5.6 is fine even though it's unsupported. I still run a PHP 5.4 program on my account...

     

    Oh, I see.  :)  Then it's their fault. 

     

    I really appreciate this support forum. You guys are such a friendly people.  :rolleyes:

    Error in Text of a Script

    in Customer Service

    Posted

    Try reuploading first, but if that doesn't help, It's probably a compatibility issue of some sort. I assume your home PC is probably running Windows?

     

    Also, what are the requirements for the software?

     

    Yes, on my PC I run Apache on windows.

     

    and these are the requirements: 

    Requirements

    - PHP 5.4.0 or above

    - PDO and MySQLI extension

    - GD Extension

    - Multibyte String (Mbstring)

    - Rewrite module

    - WHOIS Port – TCP 43 must be allowed

    - “allow_url_fopen” must be allowed.

    - SMTP Mail Server (optional)

     

     

    This is the script URL: https://codecanyon.net/item/turbo-website-reviewer-indepth-seo-analysis-tool/20069330

    Error in Text of a Script

    in Customer Service

    Posted

    I bought a web script of website analysis. It runs perfectly on my localhost in my PC. But when I install in my web server it shows some unreadable texts only in one decation. (Overview section. You can check the error here: https://www.review.edvicon.org/domain/edvicon.org. Also I attached a screenshot here.

     

    Please do let me know if it is a server error? and how should I correct it. Because the script is working fine in localhost. Please do let me know soon. It's bit urgent to solve this. Thank you.

    [Solved] Can't access web server via FTP

    in Customer Service

    Posted

    The picture seems to have gotten lost.

     

    Are you using FTP over TLS (if so that's not supported, you need to use SFTP instead)?

     

    I think yes. But it worked previously. Any how I can try SFTP. But since I haven't try it before can you guide me how to use SFTP on FileZilla? I mean what should I enter to those fields to connect?

    [Solved] Can't access web server via FTP

    in Customer Service

    Posted

    I tried to connect using FileZilla to my web server with correct credentials, it shows as 'logged in' but directory listing is not successful. It worked few weeks ago. Now this error is receiving for few days. I thought it's some server error. But the problem still there.

     

    I've attached a screenshot of the window. Please provide me a fast solution. Thank you.

    Urgent: Help with DNS Update

    in Customer Service

    Posted

    If you would like that domain to point to another server I guess not in Heliohost, you can change it through in the DNS settings menu of your provider’s account where you got your domain.

     

    No, My main domain is pointed to Heliohost server. My site is there. But I created a sub-domain through Heliohost CPanel for a blog. I just only forward that sub-domain from heliohost to another server. Not the main domain.

×
×
  • Create New...